- Recombinant Macaca mulatta (Rhesus macaque) Leucine-rich repeat-containing protein 51 (LRTOMT)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1199497
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 22,160 Da
- E Coli or Yeast
- 1-192
- (Rhesus macaque) Leucine-rich repeat-containing protein 51 (LRTOMT)
Sequence
MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQHLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLPHITTFDFSGVTKADRTTAEVWKRMNIKPKKARIKQNTL